General Information

  • ID:  hor005295
  • Uniprot ID:  P29204
  • Protein name:  Peptide YY-like
  • Gene name:  NA
  • Organism:  Pelophylax ridibundus (Marsh frog) (Rana ridibunda)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pelophylax (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPPKPENPGEDASPEEMTKYLTALRHYINLVTRQRY
  • Length:  36
  • Propeptide:  YPPKPENPGEDASPEEMTKYLTALRHYINLVTRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P29204-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P29204-F1.pdbhor005295_AF2.pdbhor005295_ESM.pdb

Physical Information

Mass: 490325 Formula: C191H294N52O58S
Absent amino acids: CFW Common amino acids: P
pI: 7.52 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -120.56 Boman Index: -9634
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 56.94
Instability Index: 7278.06 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  1620652
  • Title:  Primary structure of frog PYY: implications for the molecular evolution of the pancreatic polypeptide family.